T8181-16
TRAIL Receptor 3 (TRAIL R3, TNF-Related Apoptosis Inducing Receptor3)
Size
£448.00
- SKU:
- T8181-16
- Purity:
- Purified by affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Goat
- Immunogen:
- Synthetic peptide corresponding to aa33-63, EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC, from the extracellular domain sequence of human TRAIL-R3.
- Format:
- Supplied as a liquid in PBS, pH 7.2, 1mg/ml BSA, 0.09% sodium azide.
- Extra Details:
- TRAIL (also known as Apo-2L) is a member of the tumor necrosis factor (TNF) ligand family that rapidly induces apoptosis in a variety of transformed cell lines. A distinct receptor for TRAIL, TRAIL-R3, is restricted to peripheral blood lymphocytes (PBLs) and skeletal muscle. All three TRAIL receptors bind TRAIL with similar affinity, suggesting a complex regulation of TRAIL-mediated signals. Applications: Suitable for use in Flow Cytometry, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: ELISA: 1:25,000 Western Blot: 1:150 Immunohistochemistry (paraffin): 1:25 Flow Cytometry: 2ul per 10e6 cells in 100ul Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice