T8064-99D

Topoisomerase I (DNA Topoisomerase 1, DNA Topoisomerase I, NUP98 Fusion Gene, TOP 1, TOP1, TOP-1, TOP I, TOPI, TOP-I, Topoisomerase (DNA) I, Topoisomerase 1, Topoisomerase1, Topoisomerase-1, Topoisomerase-I, Type I DNA Topoisomerase) (Azide Free)

Size

£685.00

SKU:: T8064-99D
Purity:: Purified by immunoaffinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa692-765 from human TOP1 with GST tag. MW of GST tag alone is 26kD.
Clone:: 11C887
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22. [provided by RefSeq] Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry (Paraffin): 1-10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.