TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3)

Size

£672.00

SKU:: T8050-45A
Purity:: Purified by immunoaffinity chromatography
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Goat
Immunogen:: Synthetic peptide corresponding to aa151-181, DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ, from human TLR5.
Format:: Supplied as a liquid in PBS, pH 7.2, 1mg/ml BSA, 0.09% sodium azide.
Extra Details:: Applications: Suitable for use in ELISA, Western Blot, Flow Cytometry and Immunohistochemistry. Other applications have not been tested. Recommended Dilution: ELISA: 1:37,500 Immunohistochemistry (paraffin): 1:250 Western Blot: 1:50 Flow Cytometry: 1:200 Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.