T5499-87A
TIP 39 (Not for Export EU)
Size
£322.00
- SKU:
- T5499-87A
- Purity:
- Serum
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa62-100, SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP of human TIP 39, conjugated to KLH.
- Format:
- Supplied as a lyophilized powder in PBS pH 7.2. Reconstitute with 100ul sterile ddH2O.
- Extra Details:
- Applications: Suitable for use in ELISA, Immunohistochemistry and RIA. Other applications not tested. Recommended Dilutions: ELISA: 1:4000 RIA: 1:2000 Immunohistochemistry (Paraffin): 1:100 Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice