S8060-25N

Superoxide Dismutase, MN, Recombinant, Human (SOD Mn)

Size

£678.00

SKU:: S8060-25N
Application:: WB
Purity:: ≥90%
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 50mM Tris/HCl, pH 7.7, 0.15M sodium chloride, 5mM DTT, 10% glycerol
Extra Details:: Superoxide dismutase (SOD) is an endogenously produced intracellular enzyme present in almost every cell in the body (3). It works by catalyzing the dismutation of the superoxide radical O2¯ to O2 and H2O2, which are then metabolized to H2O and O2 by catalase and glutathione peroxidase. In general, SODs play a major role in antioxidant defense mechanisms. There are two main types of SOD in mammalian cells. One form (SOD1) contains Cu and Zn ions as a homodimer and exists in the cytoplasm. The two subunits of 16kD each are linked by two cysteines forming an intra-subunit disulfide bridge. The second form (SOD2) is a manganese containing enzyme and resides in the mitochondrial matrix. It is a homotetramer of 80kD. The third form (SOD3 or ECSOD) is like SOD1 in that it contains Cu and Zn ions, however it is distinct in that it is a homotetramer, with a mass of 30kD and it exists only in the extracellular space. SOD3 can also be distinguished by its heparin-binding capacity. Recombinant protein corresponding to human Mn SOD containing a 6-His-Tag, expressed in E. coli. GeneBank Accession Number: BC070913 Amino Acid Sequence: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing.. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Shipping Conditions:: Blue Ice