S1014-63T-BIOTIN

SMPDL3B (Acid Sphingomyelinase-like Phosphodiesterase 3b, ASM-like Phosphodiesterase 3b, ASML3B) (Biotin)

Size

£927.00

SKU:: S1014-63T-BIOTIN
Purity:: Purified.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa274-372 from human SMPDL3B with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5E12
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
Extra Details:: Located on chromosome 1, this gene encodes for acid sphingomyelinase like phosphodiesterase 3b precursor protein. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: FFGHHHTDSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKVRSPAEARGGGWEGLKCITTFPHSQLIHLPLTTEPQE Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Applications are based on unconjugated antibody.