P3126-25

PDS5, Regulator of Cohesion Maintenance, Homolog B (PDS5B, APRIN, CG008, FLJ23236, KIAA0979, RP1-267P19.1)

Size

£659.00

SKU:: P3126-25
Purity:: Purified by Protein G affinity chromatography from hybridoma culture supernatant
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to human PDS5, Regulator of Cohesion Maintenance, Homolog B consisting of amino acids from the C-terminal portion of the protein (Sequence: QWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEEEEERQSGNTEQKSKSKQHRVSRRAQQRAESPESSAIESTQSTPQKGRGRPSKTPSP)
Clone:: 8C261
Format:: Supplied as a liquid in PBS, pH 7.4, 1% BSA, 0.05% sodium azide.
Extra Details:: APRIN plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis. Applications: Suitable for use in Dot Blot and Western Blot. Other applications have not been tested. Recommended Dilution: Optimal dilution to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile glycerol (40-50), aliquot and store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.