PDKtide (Biotin)

Size

£665.00

SKU:: P3123-76A
Molecular Weight:: 4997.66
Storage Conditions:: -20°C
Supplier:: United States Biological
Extra Details:: Amino Acid Sequence: [protein fragment, 39 aa] Labeled with Biotin (linear) Molecular Formula: C222H328N56O68S4 Molecular Weight: 4997.66 Purity: ≥80% Form: Supplied as a lyophilized powder Storage and Stability: Lyophilized powder may be stored at 4°C for short-term only. Stable for 6 months after receipt at -20°C. Reconstitute (see reconstitution instructions for peptides) and store at -20°C. For maximum recovery of product, centrifuge the original vial prior to removing the cap.