P3109-13C
Parathyroid Hormone, aa1-34 (PTH, Parathormone, Parathyrin)
Size
£415.00
- SKU:
- P3109-13C
- Application:
- RIA
- Purity:
- Purified by Protein G affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Goat
- Immunogen:
- Synthetic peptide corresponding to aa1-34 from human PTH, bTG- conjugated (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF)
- Format:
- Supplied as a lyophilized powder in PBS, pH 7.2. Reconstitute in ddH2O.
- Extra Details:
- Applications: Suitable for use in RIA. Other applications not tested. Recommended Dilution: RIA: 1:30,000 Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice