P3109-10G

Parathyroid Hormone, aa1-38 (PTH, Parathormone, Parathyrin)

Size

£351.00

SKU:: P3109-10G
Purity:: Purified by Protein G affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Synthetic human PTH (aa 1-38) polylysine conjugated (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG)
Clone:: A1/64
Format:: Supplied as a lyophilized powder in 50mM Tris, pH 7.2, 0.09% sodium azide. Reconstitute in ddH2O.
Extra Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: ELISA: 1ug/ml RIA: 25ng/ml Immunohistochemistry: 2ug/ml. Frozen, paraffin Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile 40-50% glycerol, aliquot and store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.