P3109-10D

Parathyroid Hormone, aa1-38 (PTH, Parathormone, Parathyrin)

Size

£351.00

SKU:: P3109-10D
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Synthetic human PTH (aa 1-38) polylysine conjugated (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG)
Clone:: A1/70
Format:: Supplied as a lyophilized powder from PBS, pH 7.4, 20mM trehalose dihydrate, 40mM mannitol. Reconstitute with 10ul/100ul sterile ddH2O.
Extra Details:: Applications: Suitable for use in RIA and Immunohistochemistry. Other applications not tested. Recommended Dilutions: RIA: 20ng/ml Immunohistochemistry (frozen, paraffin): 2ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.