Neuropeptide Tyrosine, Human (Neuropeptide Y, NPY)

Size

£435.00

SKU:: N2176-62Z
Molecular Weight:: 4271.8
Purity:: ≥97% (HPLC)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid.
Extra Details:: Source: Synthetic peptide corresponding to YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQYNH2 of human neuropeptide Y. Molecular Weight: 4271.8amu Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing.. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.