Interleukin 21 Receptor (IL-21)

Size

£512.00

SKU:: I8442-24
Purity:: Purified by affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Goat
Immunogen:: Synthetic peptide corresponding to aa35-65, CILEMWNLHPSTLTLTWQDQYEELKDEATS, within the N-terminal region of human IL-21R.
Format:: Supplied as a liquid in PBS, 0.09% sodium azide.
Extra Details:: Human interleukin-21 receptor (IL-21R) is a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21. Interaction between IL-21R and IL-21 results in the activation of several downstream signalling molecules including JAK1 and STAT1, and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells. Applications: Suitable for use in ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilutions: ELISA: 1:50,000 Immunohistochemistry (Paraffin): 1:150 Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.