I8442-23
Interleukin 21 Receptor (IL-21)
Size
£486.00
- SKU:
- I8442-23
- Purity:
- Purified by affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to 35-65 residues, CVLETRSPNPSILSLTWQDEYEELQDQETF, at the N-terminus of mouse IL-21 receptor.
- Format:
- Supplied as a liquid in PBS, pH 7.2, 0.1% BSA, 0.09% sodium azide.
- Extra Details:
- Applications: Suitable for use in ELISA, Flow Cytometry and Immunohistochemistry. Other applications not tested. Recommended Dilutions: ELISA: 1:100,000 Immunohistochemistry: 1:300 Flow Cytometry: 1:20 Optimal dilution determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice