I8442-22
Interleukin 21 Receptor (IL-21R)
Size
£698.00
- SKU:
- I8442-22
- Purity:
- Purified by affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to 35-65 residues, CVLETRSPNPSILSLTWQDEYEELQDQETF, of N-terminus of mouse IL-21 receptor.
- Format:
- Supplied as a liquid in PBS, 1mg/ml BSA, 0.09% sodium azide.
- Extra Details:
- A novel cytokine related to IL2 and IL15 was recently identified and designated IL-21 (1). The receptor for IL-21 (IL-21R, also termed NILR for novel Interleukin receptor) is a new member of the class I cytokine receptor family (1,2). IL-21R forms a complex with the common cytokine receptor gamma chain, gammac, and mediates IL-21 signaling (3,4). Both IL-21R and the gammac are necessary for the IL-21 function. IL-21 and its receptor activate JAK-STAT signaling pathway. IL-21R is expressed in spleen, thymus, natural killer (NK), T and B cell lines. IL-21 plays a role in the proliferation and maturation of NK, B and T cell populations. Applications: Suitable for use in ELISA, Flow Cytometry and Immunohistochemistry. Other applications not tested. Recommended Dilutions: ELISA: 1:50,000 Immunohistochemistry: 1:250 Flow Cytometry: 1:25 Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice