Interleukin 21 (IL-21), NT

Size

£594.00

SKU:: I8442-10
Purity:: Purified by affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Goat
Immunogen:: Synthetic peptide corresponding to CRHLIDIVEQLKIYENDLDPELLSAPQDVK, from the N-terminus of mouse IL-21.
Format:: Supplied as a liquid in PBS, pH 7.2, 0.1% BSA, 0.09% sodium azide.
Extra Details:: Applications: Suitable for use in ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: ELISA: 1:100,000 Immunohistochemistry (paraffin): 1:500 using human spleen Optimal dilution determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.