I8442-09
Interleukin 21, NT (IL-21)
Size
£559.00
- SKU:
- I8442-09
- Purity:
- Purified by affinity chromatography
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Goat
- Immunogen:
- Synthetic peptide corresponding to aa40-68, C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE, at the N-terminal region of human IL-21
- Format:
- Supplied as a liquid in PBS, 1mg/ml BSA, 0.09% sodium azide.
- Extra Details:
- IL-21 is a 155 amino acid pro-cytokine, reduced to 133 anino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence at the C-terminus (UniProt: Q9HBE4). IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells. IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway. Applications: Suitable for use in ELISA, Immunocytochemistry and Immunohistochemistry. Other applications not tested. Recommended Dilutions: ELISA: 1:50,000 Immunocytochemistry: using human tonsil Immunohistochemistry: 1:250 Optimal dilution determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice