E2300-03A
β-Endorphin, Rat, Control Peptide
Size
£512.00
- SKU:
- E2300-03A
- Purity:
- 95+% HPLC, Mass Spec
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Format:
- Supplied as a white to off-white lyophilized powder.
- Extra Details:
- Control Peptide for E2300-03 Sequence (linear): YGGFMTSKSQTPLVTLFKNAIIKNAYKKGE Storage and Stability: Lyophilized powder may be stored at 4°C for short-term only. Stable for 12 months at -20°C. Reconstitute to nominal volume (see reconstitution instructions for peptides) and store at -20°C. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice