D8075-51A
DMP1 (Dentin Matrix Acidic Phosphoprotein 1, DMP-1, Dentin Matrix Protein 1)
Size
£685.00
- SKU:
- D8075-51A
- Purity:
- Purified.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa221-330 from human DMP1 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1D4
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- DMP1 is an extracellular matrix protein and a member of the small integrin binding ligand N-linked glycoprotein family. It is critical for proper mineralization of bone and dentin, and is present in diverse cells of bone and tooth tissues. DMP1 contains a large number of acidic domains, multiple phosphorylation sites, a functional arg-gly-asp cell attachment sequence, and a DNA binding domain. DMP1 may also have a dual function during osteoblast differentiation. In the nucleus of undifferentiated osteoblasts the unphosphorylated form acts as a transcriptional component for activation of osteoblast-specific genes like osteocalcin. During the osteoblast to osteocyte transition phase it is phosphorylated and exported into the extracellular matrix, where it regulates nucleation of hydroxyapatite. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml HeLa cells Optimal dilutions to be determined by the researcher. AA Sequence: ESIRSERGNSRMNSAGMKSKESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRSELDDNNTMEEVKSDSTENSNSRDTGLSQPRRDSKGDSQEDSKENLSQEES Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice