C8297-98W-ML650
CXCL9 (C-X-C Motif Chemokine 9, CMK, Gamma-interferon-induced Monokine, Humig, Monokine Induced by gamma Interferon, MIG, Small-inducible Cytokine B9, SCYB9) (MaxLight 650)
Size
£914.00
- SKU:
- C8297-98W-ML650
- Application:
- FLISA
- Purity:
- Purified
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length recombinant protein corresponding to aa23-125 of human CXCL9 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1F5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. CXCL9 acts as a Th1 (type 1 helper T) cell chemoattractant, and plays a role in the growth, activation and movement of cells associated with immune and inflammatory responses, and in tumor growth inhibition and angiogenesis. Studies have shown that CXCL9 is active against E.coli, S.aureus, L. monocytogenes and S.pyogenes. Applications: Suitable for use in FLISA. Other applications have not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice