CEACAM 21 (CEACAM21, Carcinoembryonic Antigen-related Cell Adhesion Molecule 21, UNQ3098/PRO10075) (APC)

Size

£934.00

SKU:: C2589-87P-APC
Application:: WB
Purity:: Purified
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length protein corresponding to aa1-191 of human CEACAM21 (AAH12001.1)
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Western Blot (Tissue lysate): 1:500-1:1000 using human liver lysates Western Blot (Transfected lysate): 1:1000-1:2000 detects a band at ~21.5kD using CEACAM21 transfected 293T lysate. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYGECSKFDSEISEDAAWPQDTFCWSLYPQSQWLSPPSKPAAPQSQRRAPWS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.