Calcitonin (Alpha CGRP, CALC1, CALCA, Calcitonin related polypeptide alpha, CGRP1, CGRP, CT, Katacalcin, KC) (Not for Export EU)

Size

£326.00

SKU:: C0115-08F
Application:: RIA
Purity:: Serum
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Sheep
Immunogen:: Synthetic peptide corresponding to CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP from human Calcitonin, comjugated to BSA
Format:: Supplied as a lyophilized powder. Reconstitute with 20ul or 100ul sterile ddH2O.
Extra Details:: Applications: Suitable for use in RIA. Other applications not tested. Recommended Dilutions: RIA: 1:80,000 Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.