C0115-03
Calcitonin-Gene related Peptide 2 (CGRP-II, Beta-ype CGRP, CALCB, CALC2) (Not for Export EU)
Size
£351.00
- SKU:
- C0115-03
- Application:
- RIA
- Purity:
- Serum
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Goat
- Immunogen:
- Synthetic human Calcitonin Gene-related Peptide, bTG- conjugated (ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF)
- Format:
- Supplied as a lyophilized powder in PBS, pH 7.2. Reconstitute with sterile dH2O.
- Extra Details:
- Applications: Suitable for use in RIA. Other applications not tested. Recommended Dilution: RIA: 1:3000 Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice