B0901-01D
BD2, aa4-41 (beta Defensin-2)
Size
£406.00
- SKU:
- B0901-01D
- Purity:
- Purified by Protein G affinity chromatography
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Sheep
- Immunogen:
- Synthetic human β-Defensin 2 (aa 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
- Format:
- Supplied as a lyophilized powder in 50mM Tris, pH 7.4. Reconstitute with 10ul/100ul sterile ddH2O.
- Extra Details:
- Applications: Suitable for use in ELISA and RIA. Other applications not tested. Recommended Dilution: ELISA: 1:5000 Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice