B0901-01B

BD2, aa4-41 (beta Defensin-2)

Size

£371.00

SKU:: B0901-01B
Purity:: Purified by Protein G affinity chromatography from cell culture supernatant.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Synthetic peptide corresponding to aa4-41, DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP of human BD2.
Clone:: L12-4C-C2
Format:: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with 10ul or 100ul sterile ddH2O.
Extra Details:: Defensins are a group of cyclic peptides containing 29-35aa, which comprise approximately 30% of the total protein content of neutrophil azurophilic granules. Various functions have been reported for the defensins, including antibacterial and antifungal activity and chemotactic activity for monocytes. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Western Blot: 5ug/ml Immunohistochemistry (Paraffin): 1:2000 Requires HIER using sodium citrate buffer pH 6.0 and trypsin. Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.