A4000-80

ATPase H+ Transporting Lysosomal Accessory Protein 1 (ATP6AP1, 16A, Ac45, ATPase H+ Transporting Lysosomal (Vacuolar Proton Pump) Subunit 1, ATP6S1, ATPase H+ Transporting Lysosomal Interacting Protein 1, ATP6IP1, CF2, H-ATPase Subunit, MGC129781, Protein XAP3, Protein XAP-3, V-ATPase Ac45 Subunit, V-ATPase S1 Accessory Protein, Vacuolar ATP Synthase Subunit S1, V-ATPase Subunit S1, VATPS1, XAP3, XAP-3) (Azide Free)

Size

£685.00

SKU:: A4000-80
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to a portion of aa51-150 of human ATP6AP1 with GST tag. MW of GST tag alone is 26kD.
Clone:: 10B237
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added (Azide free).
Extra Details:: This gene encodes a component of a multisubunit enzyme (1mD MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45kD and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. [provided by RefSeq] Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. . For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice