A4000-80-ML550
ATPase H+ Transporting Lysosomal Accessory Protein 1 (ATP6AP1, 16A, Ac45, ATPase H+ Transporting Lysosomal (Vacuolar Proton Pump) Subunit 1, ATP6S1, ATPase H+ Transporting Lysosomal Interacting Protein 1, ATP6IP1, CF2, H-ATPase Subunit, MGC129781, Protein XAP3, Protein XAP-3, V-ATPase Ac45 Subunit, V-ATPase S1 Accessory Protein, Vacuolar ATP Synthase Subunit S1, V-ATPase Subunit S1, VATPS1, XAP3, XAP-3) (Azide Free) (MaxLight 550)
Size
£914.00
- SKU:
- A4000-80-ML550
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to a portion of aa51-150 of human ATP6AP1 with GST tag. MW of GST tag alone is 26kD.
- Clone:
- 10B237
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Extra Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. This gene encodes a component of a multisubunit enzyme (1mD MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45kD and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. [provided by RefSeq] Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice