A4000-80-ML490

ATPase H+ Transporting Lysosomal Accessory Protein 1 (ATP6AP1, 16A, Ac45, ATPase H+ Transporting Lysosomal (Vacuolar Proton Pump) Subunit 1, ATP6S1, ATPase H+ Transporting Lysosomal Interacting Protein 1, ATP6IP1, CF2, H-ATPase Subunit, MGC129781, Protein XAP3, Protein XAP-3, V-ATPase Ac45 Subunit, V-ATPase S1 Accessory Protein, Vacuolar ATP Synthase Subunit S1, V-ATPase Subunit S1, VATPS1, XAP3, XAP-3) (Azide Free) (MaxLight 490)

Size

£914.00

SKU:: A4000-80-ML490
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to a portion of aa51-150 of human ATP6AP1 with GST tag. MW of GST tag alone is 26kD.
Clone:: 10B237
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Extra Details:: MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. This gene encodes a component of a multisubunit enzyme (1mD MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45kD and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. [provided by RefSeq] Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice