A2298-11M
Anti-Mullerian Hormone (AMH, Muellerian-inhibiting Factor, Muellerian-inhibiting Substance, MIS)
Size
£557.00
- SKU:
- A2298-11M
- Purity:
- Supernatant
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Synthetic peptide corresponding to human Anti-Mullerian Hormone (VPTAYAGKLLISLSEERISAHHVPNMVATEC).
- Clone:
- 10B151 (5/6)
- Format:
- Supplied as a liquid, 0.09% sodium azide.
- Extra Details:
- Anti-mullerian hormone (AMH) is originally classified as a fetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulfide linked precursor that is cleaved to release the mature 30kD homodimer. Applications: Suitable for use in Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Immunohistochemistry (Paraffin): 1:20-1:40, Requires antigen retrieval using heat treatment prior to staining of paraffin sections. Sodium citrate buffer, pH 6.0 is recommended. Optimal dilutions to be determined by the researcher. Positive Control Tissue: Ovary Hybridoma: Sp2/0 myeloma cells with spleen cells from T/O outbred mice. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice