A2275-52H
Amylin (Not for Export EU)
Size
£564.00
- SKU:
- A2275-52H
- Application:
- IHC-Fr
- Purity:
- Serum
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to human Amylin (KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2)
- Format:
- Supplied as a lyophilized powder. Reconstitute with sterile dH2O.
- Extra Details:
- Applications: Suitable for use in Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (formalin-fixed paraffin): 1:200 (ABC, DAB). Boil tissue sections in 10mM citrate buffer, pH 6.0 for 10 min followed by cooling at RT for 20 min. Optimal dilutions to be determined by the researcher. Positive Control: Human Pancreas tissue Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice