A1359-80C-APC
ALOX15 (Arachidonate 15-lipoxygenase, 15-Lipoxygenase 1, 15-Lipoxygenase Reticulocyte Arachidonate, 15-LOX, Arachidonate omega-6 Lipoxygenase) (APC)
Size
£927.00
- SKU:
- A1359-80C-APC
- Purity:
- Purified.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant protein with GST tag corresponding to aa1-63 of human ALOX15. MW of the GST tag alone is 26kD.
- Clone:
- 3D8
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. The protein also acts on C-12 of arachidonate as well as on linoleic acid. Applications: Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Formalin fixed, paraffin embedded tissues Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice