AgRP (Agouti Related Protein, ART, AGRT, ASIP2, Agouti-related transcript) (Not for Export EU)

Size

£735.00

SKU:: A1059-62J
Application:: IHC-Fr
Purity:: Serum
Storage Conditions:: 4°C (-20°C Glycerol)
Supplier:: United States Biological
Host:: Guinea Pig
Immunogen:: Synthetic peptide corresponding to aa 82-131, SPRRCVRLHESCLG QQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT a region within the carboxy domain of mouse agouti related protein.
Format:: Supplied as a lyophilized powder. Reconstitute with 50ul sterile 40-50% glycerol, PBS.
Extra Details:: AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats. Applications Suitable for use in Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Frozen): 1:1000- :2000 Optimal dilution determined by the researcher. Positive Control: Sheep brain (hypothalamus). No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP. Storage and Stability: Lyophilized powder may be stored at -20°C for short-term only. Reconstitute with sterile 40-50% glycerol, PBS. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.