ZNF44 (Zinc Finger Protein 44, DKFZp434F1811, DKFZp686L21136, GIOT-2, KOX7, ZNF, ZNF504, ZNF55, ZNF58)

Size

£685.00

SKU:: 588845
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length protein corresponding to aa1-154 from human ZNF44.
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Mouse polyclonal antibody raised against a full-length human ZNF44 protein. Applications: Suitable for use in Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MALCYGTFWGYPKMLEAANLMEGLVDIGPWVTLPRGQPEVLEWGLPKDQDSVAFEDVAVNFTHEEWALLGPSQKNLYRDVMRETIRNLNCIGMKWENQNIDDQHQNLRRNPRLSETWLQNFILIHYGHLVALSDGGLLQFSTGQGLPVTQAGVQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.