Tumor-associated Calcium Signal Transducer 2, Active, Recombinant, Human, aa27-274 (TACSTD2)

Size

£499.00

SKU:: 587071
Molecular Weight:: 56.8
Purity:: ≥90% (SDS-PAGE) Endotoxin: ≤1EU/ug
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from PBS, pH 7.4, 6% Trehalose. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1mg/ml.
Extra Details:: May function as a growth factor receptor. Partial recombinant protein corresponding to aa27-274 from Somatotropin, fused to hFc-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~56.8kD Biological Activity: Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6ng/ml. Amino Acid Sequence: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.