Transforming Growth Factor beta-3, Active, Recombinant, Human, His-Tag, aa301-412 (TGFB3)

Size

£473.00

SKU:: 587047
Molecular Weight:: 12.7
Purity:: ≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 4mM HCl. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.
Extra Details:: Involved in embryogenesis and cell differentiation. Partial recombinant protein corresponding to aa301-412 from human Transforming growth factor beta-3, fused to 6X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~12.7kD Biological Activity: The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T?cells is less than 2ng/ml. Amino Acid Sequence: ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.