SIN3-HDAC Complex-associated Factor, Active, Recombinant, Human, GST-Tag, aa1-221 (SINHCAF)

Size

£633.00

SKU:: 587036
Molecular Weight:: 51.9
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from human Tris-HCl, 50% glycerol. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1mg/ml.
Extra Details:: Subunit of the Sin3 deacetylase complex (Sin3/HDAC), this subunit is important for the repression of genes encoding components of the TGF-beta signaling pathway. Recombinant protein corresponding to aa1-221 from human SIN3-HDAC complex-associated factor, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~51.9kD Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2ug/ml can bind human SINHCAF, the EC50 of human SINHCAF protein is 31.54-38.59ug/ml. Amino Acid Sequence: MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.