MHC Class I Polypeptide-related Sequence A, Active, Recombinant, Human, hFc-Tag, aa23-308 (MICA)

Size

£351.00

SKU:: 587014
Molecular Weight:: 59.9
Purity:: ≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.
Extra Details:: Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T-cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis. Partial recombinant protein corresponding to aa23-308 from human MHC class I polypeptide-related sequence A, fused to hFc-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~59.9kD Biological Activity: The ED50 as determined by its ability to bind Human N2DL2 in functional ELISA is less than 5ug/ml. Amino Acid Sequence: AEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Shipping Conditions:: Blue Ice