Interleukin-9, Active, Recombinant, Human, His-Tag, aa19-144 (IL9)

Size

£473.00

SKU:: 587002
Molecular Weight:: 15.16
Purity:: ≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.
Extra Details:: Supports IL-2 independent and IL-4 independent growth of helper T-cells. Recombinant protein corresponding to aa19-144 from human Interleukin 9, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~15.16 kD Biological Activity: The ED50 as determined in a cell proliferation assay using MO7e human megakaryocytic leukemic cells is typically less than 0.5 ng/ml Amino Acid Sequence: QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.