Interleukin-17A, Active, Recombinant, Mouse, His-Tag, aa22-158 (Il17a)

Size

£384.00

SKU:: 586961
Molecular Weight:: 16.2
Purity:: ≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.
Extra Details:: Ligand for IL17RA. Partial recombinant protein corresponding to aa22-158 from mouse Interleukin 17A, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~16.2kD Biological Activity: The ED50 as determined by its ability to induce IL-6 secretion by NIH?3T3 mouse embryonic fibroblast cells is less than 200ng/ml. Amino Acid Sequence: TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.