Interleukin-15 Receptor Subunit alpha, Active, Recombinant, Mouse, hFc-Tag, aa33-205 (Il15ra)

Size

£384.00

SKU:: 586954
Molecular Weight:: 45.5
Purity:: ≥90% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM PBS, pH 7.4. Reconstitute with sterile ddH2O to 0.1-1mg/ml.
Extra Details:: High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Signal transduction involves SYK (By similarity). Partial recombinant protein corresponding to aa33-205 from mouse Interleukin 15 receptor subunit alpha, fused to hFc-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~45.5kD Biological Activity: The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL?2 mouse cytotoxic T cells is less than 10 ng/ml. Amino Acid Sequence: GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.