586953
Interleukin-15 Receptor Subunit alpha, Active, Recombinant, Human, hFc-Tag, aa31-205 (IL15RA)
Size
£473.00
- SKU:
- 586953
- Molecular Weight:
- 45.5
- Purity:
- ≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.
- Extra Details:
- High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK. Recombinant protein corresponding to aa31-205 from human Interleukin 15 receptor subunit alpha, fused to hFc-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~45.5kD Biological Activity: The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL?2 mouse cytotoxic T cells is less than 10ng/ml. Amino Acid Sequence: ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice