586941
Interleukin-1 Receptor Antagonist Protein, Active, Recombinant, Human, aa26-177 (IL1RN)
Size
£288.00
- SKU:
- 586941
- Molecular Weight:
- 17.26
- Purity:
- ≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 50mM Tris-HCl, pH 7.5, 0.2M sodium chloride. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.
- Extra Details:
- Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure. Recombinant protein corresponding to aa26-177 from human Interleukin1 receptor antagonist protein, expressed in E. coli. Molecular Weight: ~17.26kD Biological Activity: The ED50 as determined by the dose-dependent inhibition of IL-1 stimulation of D10S cells is typically 0.5ng/ml Amino Acid Sequence: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice