586908
Granulocyte-macrophage Colony-stimulating Factor Receptor Subunit alpha, Active, Recombinant, Human, His-Tag, aa23-320 (CSF2RA)
Size
£351.00
- SKU:
- 586908
- Molecular Weight:
- 35.5
- Purity:
- ≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM PBS, pH 7.4. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.
- Extra Details:
- Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. Partial Recombinant protein corresponding to aa23-320 from human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha fused to 6X His-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~35.5kD Biological Activity: The ED50 as determined by its ability to inhibit GM-CSF-dependent proliferation of TF?1 human erythroleukemic cells is less than 5ng/ml. Amino Acid Sequence: EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice