Fms-related Tyrosine Kinase 3 Ligand, Active, Recombinant, Human, aa27-181 (FLT3LG)(GMP)

Size

£247.00

SKU:: 586901
Molecular Weight:: 17.6
Purity:: ≥98% (SDS-PAGE and HPLC) Endotoxin: ≤1EU/ug
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from PBS, pH 7.0. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1mg/ml.
Extra Details:: Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. Partial recombinant protein corresponding to aa27-181 from human Fms-related Tyrosine Kinase 3 Ligand, expressed in E. coli. Molecular Weight: ~17.6kD Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human AML5 cells is less than 1.0ng/ml, corresponding to a specific activity of >1.0×106IU/mg. Amino Acid Sequence: TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.