Carbonic Anhydrase-related Protein, Active, Recombinant, Human, His-Tag, aa2-290 (CA8)

Size

£364.00

SKU:: 586860
Molecular Weight:: 34.04
Purity:: ≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, pH 8.5, 500mM sodium chloride, 1mM DTT.
Extra Details:: Does not have a carbonic anhydrase catalytic activity. Partial recombinant protein corresponding to aa2-290 from human Carbonic anhydrase-related protein, fused to 6xHis-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~34.04kD Biological Activity: The esterase activity is determined to be is 162.5 pmol/min/μg. Amino Acid Sequence: ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.