Arginase-1, Active, Recombinant, Human, His-Tag, aa1-322 (ARG1)

Size

£512.00

SKU:: 586836
Molecular Weight:: 35.6
Purity:: ≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, pH 7.4, 150mM sodium chloride, 1mM DTT, 20% glycerol. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.
Extra Details:: Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys. Recombinant protein corresponding to aa1-322 from human Arginase-1, fused to His-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~35.6kD Biological Activity: Specific activity as determined by the production of urea during the hydrolysis of arginine is greater than 30,000pmol/min/g. Amino Acid Sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Shipping Conditions:: Blue Ice