Thiol:disulfide interchange Protein DsbA, Recombinant, Pseudomonas syringae pv. tomato, aa23-214, His-Tag

Size

£633.00

SKU:: 586485
Molecular Weight:: 25.1
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Involved in disulfide-bond formation. Acts by transferring its disulfide bond to other proteins. Source: Recombinant protein corresponding to aa23-214 from Pseudomonas syringae pv. tomato Thiol:disulfide interchange protein DsbA, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~25.1kD Amino Acid Sequence: AEPIESGKQYVELTSAVPVAVPGKIEVIELFWYGCPHCYAFEPTINPWVEKLPSDVNFVRIPAMFGGPWDAHGQLFITLDTMGVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKDDFLKTFDSFAVKGKIAQYKELAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLQVADQLIDKERAAAKAAK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.