Statherin, Recombinant, Human, aa20-62, His-SUMO-Tag

Size

£499.00

SKU:: 586404
Molecular Weight:: 23.7
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface. Source: Recombinant protein corresponding to aa20-62 from human Statherin, fused to 10X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~23.7kD Amino Acid Sequence: DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.