Rhodopsin, Recombinant, Bovine, aa1-36, His-KSI-Tag

Size

£633.00

SKU:: 586166
Molecular Weight:: 19.5
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling. Source: Recombinant protein corresponding to aa1-36 from bovine Rhodopsin, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~19.5kD Amino Acid Sequence: MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.