Poly (3-hydroxybutyrate) Depolymerase, Recombinant, Ralstonia pickettii, aa28-488, His-Tag

Size

£633.00

SKU:: 585827
Molecular Weight:: 50.9
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: This protein degrades water-insoluble and water-soluble PHB to monomeric D(-)-3-hydroxybutyrate. Source: Recombinant protein corresponding to aa28-488 from Ralstonia pickettii Poly (3-hydroxybutyrate) depolymerase, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~50.9kD Amino Acid Sequence: ATAGPGAWSSQQTWAADSVNGGNLTGYFYWPASQPTTPNGKRALVLVLHGCVQTASGDVIDNANGAGFNWKSVADQYGAVILAPNATGNVYSNHCWDYANASPSRTAGHVGVLLDLVNRFVTNSQYAIDPNQVYVAGLSSGGGMTMVLGCIAPDIFAGIGINAGPPPGTTTAQIGYVPSGFTATTAANKCNAWAGSNAGKFSTQIAGAVWGTSDYTVAQAYGPMDAAAMRLVYGGNFTQGSQVSISGGGTNTPYTDSNGKVRTHEISVSGMAHAWPAGTGGDNTNYVDATHINYPVFVMDYWVKNNLRAGSGTGQAGSAPTGLAVTATTSTSVSLSWNAVANASSYGVYRNGSKVGSATATAYTDSGLIAGTTYSYTVTAVDPTAGESQPSAAVSATTKSAFTCTATTASNYAHVQAGRAHDSGGIAYANGSNQSMGLDNLFYTSTLAQTAAGYYIVGNCP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.